FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0215, 111 aa
  1>>>pF1KE0215 111 - 111 aa - 111 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.3442+/-0.00054; mu= 15.3066+/- 0.032
 mean_var=55.2198+/-10.695, 0's: 0 Z-trim(112.9): 13  B-trim: 0 in 0/50
 Lambda= 0.172594
 statistics sampled from 13542 (13554) to 13542 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.789), E-opt: 0.2 (0.416), width:  16
 Scan time:  1.570

The best scores are:                                      opt bits E(32554)
CCDS4188.1 CXCL14 gene_id:9547|Hs108|chr5          ( 111)  752 194.0 1.6e-50


>>CCDS4188.1 CXCL14 gene_id:9547|Hs108|chr5               (111 aa)
 initn: 752 init1: 752 opt: 752  Z-score: 1020.7  bits: 194.0 E(32554): 1.6e-50
Smith-Waterman score: 752; 100.0% identity (100.0% similar) in 111 aa overlap (1-111:1-111)

               10        20        30        40        50        60
pF1KE0 MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS41 MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
               10        20        30        40        50        60

               70        80        90       100       110 
pF1KE0 PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
       :::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS41 PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
               70        80        90       100       110 




111 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 20:58:35 2016 done: Thu Nov  3 20:58:35 2016
 Total Scan time:  1.570 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]