FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE0220, 68 aa
  1>>>pF1KE0220 68 - 68 aa - 68 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences
Statistics:  Expectation_n fit: rho(ln(x))= 4.8337+/-0.000617; mu= 8.3584+/- 0.037
 mean_var=42.7436+/- 8.623, 0's: 0 Z-trim(108.2): 7  B-trim: 409 in 1/50
 Lambda= 0.196173
 statistics sampled from 10034 (10035) to 10034 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.723), E-opt: 0.2 (0.308), width:  16
 Scan time:  1.070
The best scores are:                                      opt bits E(32554)
CCDS5513.1 SEC61G gene_id:23480|Hs108|chr7         (  68)  449 133.6 8.9e-33
>>CCDS5513.1 SEC61G gene_id:23480|Hs108|chr7              (68 aa)
 initn: 449 init1: 449 opt: 449  Z-score: 702.0  bits: 133.6 E(32554): 8.9e-33
Smith-Waterman score: 449; 100.0% identity (100.0% similar) in 68 aa overlap (1-68:1-68)
               10        20        30        40        50        60
pF1KE0 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS55 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
               10        20        30        40        50        60
               
pF1KE0 INNIIVGG
       ::::::::
CCDS55 INNIIVGG
               
68 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 20:51:06 2016 done: Thu Nov  3 20:51:06 2016
 Total Scan time:  1.070 Total Display time: -0.030
Function used was FASTA [36.3.4 Apr, 2011]