FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0223, 79 aa 1>>>pF1KE0223 79 - 79 aa - 79 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.6087+/-0.000578; mu= 12.6546+/- 0.035 mean_var=75.9176+/-15.019, 0's: 0 Z-trim(113.7): 62 B-trim: 0 in 0/53 Lambda= 0.147198 statistics sampled from 14233 (14297) to 14233 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.824), E-opt: 0.2 (0.439), width: 16 Scan time: 1.340 The best scores are: opt bits E(32554) CCDS14176.1 S100G gene_id:795|Hs108|chrX ( 79) 505 114.9 5.2e-27 >>CCDS14176.1 S100G gene_id:795|Hs108|chrX (79 aa) initn: 505 init1: 505 opt: 505 Z-score: 598.4 bits: 114.9 E(32554): 5.2e-27 Smith-Waterman score: 505; 100.0% identity (100.0% similar) in 79 aa overlap (1-79:1-79) 10 20 30 40 50 60 pF1KE0 MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN 10 20 30 40 50 60 70 pF1KE0 GDGEVSFEEFQVLVKKISQ ::::::::::::::::::: CCDS14 GDGEVSFEEFQVLVKKISQ 70 79 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 20:47:00 2016 done: Thu Nov 3 20:47:01 2016 Total Scan time: 1.340 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]