FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0224, 89 aa 1>>>pF1KE0224 89 - 89 aa - 89 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0027+/-0.000732; mu= 9.2133+/- 0.044 mean_var=46.6125+/- 9.513, 0's: 0 Z-trim(105.2): 11 B-trim: 0 in 0/50 Lambda= 0.187855 statistics sampled from 8317 (8322) to 8317 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.256), width: 16 Scan time: 1.340 The best scores are: opt bits E(32554) CCDS8688.1 IAPP gene_id:3375|Hs108|chr12 ( 89) 562 159.5 2.5e-40 >>CCDS8688.1 IAPP gene_id:3375|Hs108|chr12 (89 aa) initn: 562 init1: 562 opt: 562 Z-score: 837.4 bits: 159.5 E(32554): 2.5e-40 Smith-Waterman score: 562; 100.0% identity (100.0% similar) in 89 aa overlap (1-89:1-89) 10 20 30 40 50 60 pF1KE0 MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS86 MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL 10 20 30 40 50 60 70 80 pF1KE0 SSTNVGSNTYGKRNAVEVLKREPLNYLPL ::::::::::::::::::::::::::::: CCDS86 SSTNVGSNTYGKRNAVEVLKREPLNYLPL 70 80 89 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 01:21:29 2016 done: Sat Nov 5 01:21:29 2016 Total Scan time: 1.340 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]