Result of FASTA (omim) for pF1KE0249
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0249, 84 aa
  1>>>pF1KE0249 84 - 84 aa - 84 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.7698+/-0.000219; mu= 3.6249+/- 0.014
 mean_var=116.5675+/-23.288, 0's: 0 Z-trim(126.9): 1  B-trim: 0 in 0/57
 Lambda= 0.118792
 statistics sampled from 54102 (54103) to 54102 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.896), E-opt: 0.2 (0.634), width:  16
 Scan time:  4.280

The best scores are:                                      opt bits E(85289)
NP_851854 (OMIM: 608211) kidney-associated antigen (  84)  589 109.5 6.8e-25


>>NP_851854 (OMIM: 608211) kidney-associated antigen 1 [  (84 aa)
 initn: 589 init1: 589 opt: 589  Z-score: 567.9  bits: 109.5 E(85289): 6.8e-25
Smith-Waterman score: 589; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84)

               10        20        30        40        50        60
pF1KE0 MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_851 MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
               10        20        30        40        50        60

               70        80    
pF1KE0 HRTQGAGSPPETNEKLTNPQVKEK
       ::::::::::::::::::::::::
NP_851 HRTQGAGSPPETNEKLTNPQVKEK
               70        80    




84 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 19:15:32 2016 done: Thu Nov  3 19:15:32 2016
 Total Scan time:  4.280 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com