FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0280, 71 aa 1>>>pF1KE0280 71 - 71 aa - 71 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 3.9610+/-0.000399; mu= 15.2630+/- 0.024 mean_var=55.4618+/-10.697, 0's: 0 Z-trim(118.9): 29 B-trim: 71 in 2/50 Lambda= 0.172218 statistics sampled from 19968 (19998) to 19968 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.905), E-opt: 0.2 (0.614), width: 16 Scan time: 1.160 The best scores are: opt bits E(32554) CCDS33457.1 DEFB124 gene_id:245937|Hs108|chr20 ( 71) 517 134.3 6.1e-33 >>CCDS33457.1 DEFB124 gene_id:245937|Hs108|chr20 (71 aa) initn: 517 init1: 517 opt: 517 Z-score: 704.8 bits: 134.3 E(32554): 6.1e-33 Smith-Waterman score: 517; 100.0% identity (100.0% similar) in 71 aa overlap (1-71:1-71) 10 20 30 40 50 60 pF1KE0 MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYAL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYAL 10 20 30 40 50 60 70 pF1KE0 KPPPVPKHEYE ::::::::::: CCDS33 KPPPVPKHEYE 70 71 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 17:49:50 2016 done: Thu Nov 3 17:49:50 2016 Total Scan time: 1.160 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]