FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0475, 252 aa 1>>>pF1KE0475 252 - 252 aa - 252 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.5445+/-0.000808; mu= 15.0036+/- 0.049 mean_var=86.7940+/-17.206, 0's: 0 Z-trim(108.9): 6 B-trim: 2 in 1/51 Lambda= 0.137667 statistics sampled from 10545 (10547) to 10545 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.703), E-opt: 0.2 (0.324), width: 16 Scan time: 2.010 The best scores are: opt bits E(32554) CCDS10722.1 ORC6 gene_id:23594|Hs108|chr16 ( 252) 1626 332.3 1.9e-91 >>CCDS10722.1 ORC6 gene_id:23594|Hs108|chr16 (252 aa) initn: 1626 init1: 1626 opt: 1626 Z-score: 1755.1 bits: 332.3 E(32554): 1.9e-91 Smith-Waterman score: 1626; 100.0% identity (100.0% similar) in 252 aa overlap (1-252:1-252) 10 20 30 40 50 60 pF1KE0 MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 CPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 CPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKS 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE0 YESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 YESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLE 130 140 150 160 170 180 190 200 210 220 230 240 pF1KE0 KIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKIL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 KIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKIL 190 200 210 220 230 240 250 pF1KE0 ENAASAQKATAE :::::::::::: CCDS10 ENAASAQKATAE 250 252 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 05:51:57 2016 done: Thu Nov 3 05:51:57 2016 Total Scan time: 2.010 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]