FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0580, 156 aa 1>>>pF1KE0580 156 - 156 aa - 156 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3576+/-0.000683; mu= 12.6882+/- 0.041 mean_var=74.6831+/-14.959, 0's: 0 Z-trim(110.6): 8 B-trim: 5 in 2/51 Lambda= 0.148410 statistics sampled from 11722 (11724) to 11722 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.743), E-opt: 0.2 (0.36), width: 16 Scan time: 1.730 The best scores are: opt bits E(32554) CCDS11241.1 RPL23A gene_id:6147|Hs108|chr17 ( 156) 812 182.2 1.1e-46 >>CCDS11241.1 RPL23A gene_id:6147|Hs108|chr17 (156 aa) initn: 812 init1: 812 opt: 812 Z-score: 951.6 bits: 182.2 E(32554): 1.1e-46 Smith-Waterman score: 812; 83.3% identity (91.7% similar) in 156 aa overlap (1-156:1-156) 10 20 30 40 50 60 pF1KE0 MALKAKKEAPASPEAEAKAKALKAKKAALKGVHSHIKKKTRTSLTFQRPKTLRRRRRPEY :: :::::::: :.:::::::::::::.::::::: ::: ::: ::.:::::: ::.:.: CCDS11 MAPKAKKEAPAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 PWKSTPRRNKLGHYAVIKFPLTTESAVKRTEENNTLLFTVDVKANKHQIKQAVKKLYDGD : ::.:::::: :::.::::::::::.:. :.::::.: ::::::::::::::::::: : CCDS11 PRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDID 70 80 90 100 110 120 130 140 150 pF1KE0 VAEVTTLIPPDGEKKACVRLAPDYDALDVANKIGII ::.:.::: ::::::: ::::::::::::::::::: CCDS11 VAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII 130 140 150 156 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Wed Nov 2 22:06:50 2016 done: Wed Nov 2 22:06:50 2016 Total Scan time: 1.730 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]