FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0621, 190 aa 1>>>pF1KE0621 190 - 190 aa - 190 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.7854+/-0.000841; mu= 11.4301+/- 0.051 mean_var=101.7691+/-21.916, 0's: 0 Z-trim(108.6): 107 B-trim: 576 in 1/53 Lambda= 0.127135 statistics sampled from 10216 (10349) to 10216 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.71), E-opt: 0.2 (0.318), width: 16 Scan time: 1.830 The best scores are: opt bits E(32554) CCDS6839.1 RBM18 gene_id:92400|Hs108|chr9 ( 190) 1258 240.7 4.1e-64 >>CCDS6839.1 RBM18 gene_id:92400|Hs108|chr9 (190 aa) initn: 1258 init1: 1258 opt: 1258 Z-score: 1264.5 bits: 240.7 E(32554): 4.1e-64 Smith-Waterman score: 1258; 100.0% identity (100.0% similar) in 190 aa overlap (1-190:1-190) 10 20 30 40 50 60 pF1KE0 MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 SGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKIL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 SGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKIL 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE0 PISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS68 PISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTP 130 140 150 160 170 180 190 pF1KE0 YSRTAWKSRR :::::::::: CCDS68 YSRTAWKSRR 190 190 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 17:53:26 2016 done: Sat Nov 5 17:53:26 2016 Total Scan time: 1.830 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]