FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1098, 315 aa 1>>>pF1KE1098 315 - 315 aa - 315 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.3631+/-0.000415; mu= 10.3253+/- 0.026 mean_var=78.7141+/-16.069, 0's: 0 Z-trim(110.5): 68 B-trim: 50 in 1/52 Lambda= 0.144560 statistics sampled from 18819 (18878) to 18819 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.586), E-opt: 0.2 (0.221), width: 16 Scan time: 6.190 The best scores are: opt bits E(85289) NP_004085 (OMIM: 603907) eukaryotic translation in ( 315) 2020 431.1 1.4e-120 >>NP_004085 (OMIM: 603907) eukaryotic translation initia (315 aa) initn: 2020 init1: 2020 opt: 2020 Z-score: 2285.7 bits: 431.1 E(85289): 1.4e-120 Smith-Waterman score: 2020; 100.0% identity (100.0% similar) in 315 aa overlap (1-315:1-315) 10 20 30 40 50 60 pF1KE1 MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE1 YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI 130 140 150 160 170 180 190 200 210 220 230 240 pF1KE1 NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT 190 200 210 220 230 240 250 260 270 280 290 300 pF1KE1 TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV 250 260 270 280 290 300 310 pF1KE1 DGDDDAEEMEAKAED ::::::::::::::: NP_004 DGDDDAEEMEAKAED 310 315 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 19:12:17 2016 done: Sat Nov 5 19:12:18 2016 Total Scan time: 6.190 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]