FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2763, 118 aa 1>>>pF1KE2763 118 - 118 aa - 118 aa Library: human.CCDS.faa 18921897 residues in 33420 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9592+/-0.00054; mu= 11.7187+/- 0.033 mean_var=54.3257+/-11.137, 0's: 0 Z-trim(112.9): 2 B-trim: 793 in 1/49 Lambda= 0.174009 statistics sampled from 13802 (13803) to 13802 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.795), E-opt: 0.2 (0.413), width: 16 Scan time: 0.940 The best scores are: opt bits E(33420) CCDS10911.1 FA2H gene_id:79152|Hs109|chr16 ( 372) 786 204.5 3.9e-53 >>CCDS10911.1 FA2H gene_id:79152|Hs109|chr16 (372 aa) initn: 786 init1: 786 opt: 786 Z-score: 1067.6 bits: 204.5 E(33420): 3.9e-53 Smith-Waterman score: 786; 98.2% identity (99.1% similar) in 113 aa overlap (6-118:260-372) 10 20 30 pF1KE2 MPKPLHLQAPFDGSRLVFPPVPASLVIGVFYLCMQ : .::::::::::::::::::::::::::: CCDS10 EYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQ 230 240 250 260 270 280 40 50 60 70 80 90 pF1KE2 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG 290 300 310 320 330 340 100 110 pF1KE2 ISTKLWDYCFHTLTPEKPHLKTQ ::::::::::::::::::::::: CCDS10 ISTKLWDYCFHTLTPEKPHLKTQ 350 360 370 118 residues in 1 query sequences 18921897 residues in 33420 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Oct 3 17:24:22 2019 done: Thu Oct 3 17:24:22 2019 Total Scan time: 0.940 Total Display time: 0.020 Function used was FASTA [36.3.4 Apr, 2011]