FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2763, 118 aa 1>>>pF1KE2763 118 - 118 aa - 118 aa Library: /omim/omim.rfq.tfa 64369986 residues in 92320 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.2929+/-0.000257; mu= 15.7396+/- 0.016 mean_var=56.2024+/-11.560, 0's: 0 Z-trim(120.4): 2 B-trim: 1112 in 1/49 Lambda= 0.171079 statistics sampled from 37097 (37099) to 37097 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.782), E-opt: 0.2 (0.402), width: 16 Scan time: 2.700 The best scores are: opt bits E(92320) XP_011521621 (OMIM: 611026,612319) fatty acid 2-hy ( 292) 786 201.3 7.9e-52 NP_077282 (OMIM: 611026,612319) fatty acid 2-hydro ( 372) 786 201.4 9.5e-52 >>XP_011521621 (OMIM: 611026,612319) fatty acid 2-hydrox (292 aa) initn: 786 init1: 786 opt: 786 Z-score: 1052.1 bits: 201.3 E(92320): 7.9e-52 Smith-Waterman score: 786; 98.2% identity (99.1% similar) in 113 aa overlap (6-118:180-292) 10 20 30 pF1KE2 MPKPLHLQAPFDGSRLVFPPVPASLVIGVFYLCMQ : .::::::::::::::::::::::::::: XP_011 EYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQ 150 160 170 180 190 200 40 50 60 70 80 90 pF1KE2 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG 210 220 230 240 250 260 100 110 pF1KE2 ISTKLWDYCFHTLTPEKPHLKTQ ::::::::::::::::::::::: XP_011 ISTKLWDYCFHTLTPEKPHLKTQ 270 280 290 >>NP_077282 (OMIM: 611026,612319) fatty acid 2-hydroxyla (372 aa) initn: 786 init1: 786 opt: 786 Z-score: 1050.7 bits: 201.4 E(92320): 9.5e-52 Smith-Waterman score: 786; 98.2% identity (99.1% similar) in 113 aa overlap (6-118:260-372) 10 20 30 pF1KE2 MPKPLHLQAPFDGSRLVFPPVPASLVIGVFYLCMQ : .::::::::::::::::::::::::::: NP_077 EYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQ 230 240 250 260 270 280 40 50 60 70 80 90 pF1KE2 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_077 LILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFG 290 300 310 320 330 340 100 110 pF1KE2 ISTKLWDYCFHTLTPEKPHLKTQ ::::::::::::::::::::::: NP_077 ISTKLWDYCFHTLTPEKPHLKTQ 350 360 370 118 residues in 1 query sequences 64369986 residues in 92320 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Oct 3 17:24:23 2019 done: Thu Oct 3 17:24:23 2019 Total Scan time: 2.700 Total Display time: 0.020 Function used was FASTA [36.3.4 Apr, 2011]