FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2788, 301 aa 1>>>pF1KE2788 301 - 301 aa - 301 aa Library: human.CCDS.faa 18921897 residues in 33420 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.4151+/-0.000981; mu= 10.2598+/- 0.059 mean_var=76.5053+/-15.140, 0's: 0 Z-trim(104.5): 17 B-trim: 5 in 2/49 Lambda= 0.146632 statistics sampled from 8058 (8063) to 8058 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.61), E-opt: 0.2 (0.241), width: 16 Scan time: 1.150 The best scores are: opt bits E(33420) CCDS14224.1 TASL gene_id:80231|Hs109|chrX ( 301) 1934 418.6 3e-117 >>CCDS14224.1 TASL gene_id:80231|Hs109|chrX (301 aa) initn: 1934 init1: 1934 opt: 1934 Z-score: 2218.6 bits: 418.6 E(33420): 3e-117 Smith-Waterman score: 1934; 100.0% identity (100.0% similar) in 301 aa overlap (1-301:1-301) 10 20 30 40 50 60 pF1KE2 MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKS 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 SGKFISSVHSRESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 SGKFISSVHSRESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSI 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE2 CKNYNDLQIAGGQVMAINSVTTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 CKNYNDLQIAGGQVMAINSVTTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKP 130 140 150 160 170 180 190 200 210 220 230 240 pF1KE2 IQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQIL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 IQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQIL 190 200 210 220 230 240 250 260 270 280 290 300 pF1KE2 ASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 ASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN 250 260 270 280 290 300 pF1KE2 P : CCDS14 P 301 residues in 1 query sequences 18921897 residues in 33420 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Aug 16 14:33:06 2021 done: Mon Aug 16 14:33:06 2021 Total Scan time: 1.150 Total Display time: 0.010 Function used was FASTA [36.3.4 Apr, 2011]