FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5117, 118 aa
  1>>>pF1KE5117     118 - 118 aa - 118 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2550+/-0.00051; mu= 12.4700+/- 0.031
 mean_var=75.2412+/-14.751, 0's: 0 Z-trim(116.1): 2  B-trim: 2 in 1/52
 Lambda= 0.147859
 statistics sampled from 16723 (16725) to 16723 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.851), E-opt: 0.2 (0.514), width:  16
 Scan time:  0.780

The best scores are:                                      opt bits E(32554)
CCDS6466.1 MLANA gene_id:2315|Hs108|chr9           ( 118)  837 186.1 4.3e-48


>>CCDS6466.1 MLANA gene_id:2315|Hs108|chr9                (118 aa)
 initn: 837 init1: 837 opt: 837  Z-score: 976.8  bits: 186.1 E(32554): 4.3e-48
Smith-Waterman score: 837; 100.0% identity (100.0% similar) in 118 aa overlap (1-118:1-118)

               10        20        30        40        50        60
pF1KE5 MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS64 MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
               10        20        30        40        50        60

               70        80        90       100       110        
pF1KE5 SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS64 SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
               70        80        90       100       110        




118 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Feb 27 10:34:25 2017 done: Mon Feb 27 10:34:26 2017
 Total Scan time:  0.780 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]