FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5117, 118 aa
  1>>>pF1KE5117     118 - 118 aa - 118 aa
Library: /omim/omim.rfq.tfa
  61265892 residues in 86068 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2390+/-0.000241; mu= 12.6262+/- 0.015
 mean_var=77.6548+/-15.325, 0's: 0 Z-trim(123.5): 1  B-trim: 157 in 2/55
 Lambda= 0.145543
 statistics sampled from 43603 (43608) to 43603 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.846), E-opt: 0.2 (0.507), width:  16
 Scan time:  2.200

The best scores are:                                      opt bits E(86068)
NP_005502 (OMIM: 605513) melanoma antigen recogniz ( 118)  837 183.4 7.3e-47


>>NP_005502 (OMIM: 605513) melanoma antigen recognized b  (118 aa)
 initn: 837 init1: 837 opt: 837  Z-score: 962.4  bits: 183.4 E(86068): 7.3e-47
Smith-Waterman score: 837; 100.0% identity (100.0% similar) in 118 aa overlap (1-118:1-118)

               10        20        30        40        50        60
pF1KE5 MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_005 MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
               10        20        30        40        50        60

               70        80        90       100       110        
pF1KE5 SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_005 SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
               70        80        90       100       110        




118 residues in 1 query   sequences
61265892 residues in 86068 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Feb 27 10:34:26 2017 done: Mon Feb 27 10:34:26 2017
 Total Scan time:  2.200 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]