hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data/Pfam.bin
Sequence file:            /tmp/20091008/iprscan-20091008-16354349/chunk_1/iprscan-20091008-16354349.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pF1KE0685
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
PF00076.12.fs RNA recognition motif. (a.k.a. RRM, RBD, or     20.4    5.7e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
PF00076.12.fs   1/1      61    90 ..     1    30 [.    20.4  5.7e-05

Alignments of top-scoring domains:
PF00076.12.fs: domain 1 of 1, from 61 to 90: score 20.4, E = 5.7e-05
                   *->lfVgNLppdtteedLkdlFskfGpiesiki<-*
                      lfV N pp++tee L +l s +G i s+++   
   pF1KE0685    61    LFVLNVPPYCTEESLSRLLSTCGLIQSVEL    90   

//