hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/Pfam.bin Sequence file: /tmp/20090425/iprscan-20090425-14005423/chunk_1/iprscan-20090425-14005423.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: pF1KB6951 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF02197.7.ls Regulatory subunit of type II PKA R-subunit 17.1 0.0022 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF02197.7.ls 1/1 12 49 .. 1 39 [] 17.1 0.0022 Alignments of top-scoring domains: PF02197.7.ls: domain 1 of 1, from 12 to 49: score 17.1, E = 0.0022 *->hglqaLLedltveVlraqPsDlvqFaadYFnekLeeqRa<-* ++l+ L++++ + r qP Dl q aadYF e L + + pF1KB6951 12 PELPKMLKEFAKAAIRVQPQDLIQWAADYF-EALSRGET 49 //